PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB03G17420.1
Common NameLOC102704873
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family HD-ZIP
Protein Properties Length: 236aa    MW: 25879.1 Da    PI: 7.5679
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB03G17420.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.98.6e-1960113356
                   --SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
      Homeobox   3 kRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                   k++++++eq + Le  F+k+r++ + ++ +LA++lgL+ +qV vWFqNrRa++k
  OB03G17420.1  60 KKRRLSDEQARFLEMSFKKERKLETPRKVQLAAELGLDAKQVAVWFQNRRARHK 113
                   56689***********************************************99 PP

2HD-ZIP_I/II113.71.1e-3660150292
   HD-ZIP_I/II   2 kkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                   kkrrls+eq+++LE+sF++e+kLe+ rKv+la eLgl+++qvavWFqnrRAR+k+k +E+++++L++a+da++ +n++Le+e  +L+e+l+
  OB03G17420.1  60 KKRRLSDEQARFLEMSFKKERKLETPRKVQLAAELGLDAKQVAVWFQNRRARHKSKLMEEEFAKLRSAHDAVVLQNCHLETELLKLKERLA 150
                   9**************************************************************************************9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5007116.60155115IPR001356Homeobox domain
SuperFamilySSF466891.39E-1657114IPR009057Homeodomain-like
SMARTSM003891.6E-1658119IPR001356Homeobox domain
CDDcd000867.94E-1660115No hitNo description
Gene3DG3DSA:1.10.10.605.0E-1760113IPR009057Homeodomain-like
PfamPF000462.7E-1660113IPR001356Homeobox domain
PRINTSPR000315.2E-68695IPR000047Helix-turn-helix motif
PROSITE patternPS00027090113IPR017970Homeobox, conserved site
PRINTSPR000315.2E-695111IPR000047Helix-turn-helix motif
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 236 aa     Download sequence    Send to blast
MTREGEEKLL FPSFAFPECF PEAVTSGGEQ KKARQRRRRK VKPEAFAAAT GESGVDEQAK  60
KRRLSDEQAR FLEMSFKKER KLETPRKVQL AAELGLDAKQ VAVWFQNRRA RHKSKLMEEE  120
FAKLRSAHDA VVLQNCHLET ELLKLKERLA DVEEEKAKLA AAAAATGGGS AGGGGGSSPS  180
SSSFSTVTYH PALVGQFGVE AAAEEADLYM SEYAYNNYML ELAAAGYGGG VYDQFS
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK0734460.0AK073446.1 Oryza sativa Japonica Group cDNA clone:J033043C24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_006649569.11e-171PREDICTED: homeobox-leucine zipper protein HOX12
SwissprotQ10QF21e-120HOX12_ORYSJ; Homeobox-leucine zipper protein HOX12
TrEMBLJ3LL161e-171J3LL16_ORYBR; Uncharacterized protein
STRINGOB03G17420.11e-171(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP200638101
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G36740.13e-31homeobox protein 40